Search by job, company or skills

Early Applicant
  • Posted 5 hours ago
  • Be among the first 10 applicants

Job Description

JOB DESCRIPTION

InThisRole,YourResponsibilitiesWillBe:

  • SupportProjectManagersandIPMsinexecutingprojectcoordinationactivities.
  • Assistinmaintainingprojectschedules,trackers,andstatusreports.
  • Monitorprojectdocumentationandensurerecordsarecompleteanduptodate.
  • Followupwithinternalteamstotrackcustomerapprovals,documentationsubmissions,inspections,andprojectmilestones.
  • Supportordermanagementactivitiesbyupdatingprojectdatainbusinesssystems.
  • Assistinpreparingpresentations,dashboards,andprojectperformancereports.
  • Coordinatemeetings,captureactionitems,andtrackclosureofassignedtasks.
  • Helpidentifyprocessimprovementopportunitiestoenhanceprojectefficiencyandreportingaccuracy.
  • Ensurecompliancewithestablishedprojectmanagementprocessesanddocumentationrequirements.
  • Collaboratewithcross-functionalteamstosupporttimelyprojectexecutionanddelivery.

WhoYouAre:

You consistently focus on the highest-priority work and deliver commitments with a strong sense of accountability. You proactively seek information from multiple sources to identify trends, solve problems, and support effective decision-making. You communicate clearly and openly with diversestakeholderswhilebuildingcollaborativerelationshipsacrossteams.Youadapttochangingpriorities,learnquicklyfromnewexperiences,andcontinuouslylookforopportunitiestoimproveprocessesandoutcomes.

ForThisRole,YouWillNeed:

  • PursuingaBachelor'sorMaster'sdegreeinEngineering,BusinessAdministration,ProjectManagement,Operations,orarelatedfield.
  • Strongorganizationalandcoordinationskills.
  • ProficiencyinMicrosoftExcel,PowerPoint,andotherMicrosoftOfficeapplications.
  • Goodwrittenandverbalcommunicationskills.
  • Abilitytomanagemultipletasksandmeetdeadlinesinafast-pacedenvironment.
  • Analyticalmindsetwithattentiontodetail.
  • Willingnesstolearnprojectmanagementandorderexecutionprocesses.
  • Abilitytoworkeffectivelybothindependentlyandwithinateamenvironment.

PreferredQualificationsThatSetYouApart:

  • Exposuretoprojectmanagementconcepts,projectcoordination,orinternshipexperience.
  • FamiliaritywithERP,projectmanagement,orreportingtools.
  • Knowledgeofdataanalysis,dashboardcreation,orprocessimprovementmethodologies.
  • Understandingofindustrialautomation,engineeringprojects,ormanufacturingenvironments.
  • ExperienceusingPowerBIoradvancedExcelfunctionality.

OurCultureandCommitmentToYou:

At Emerson, we foster a culture where every employee is valued, respected, and empowered to contribute their best work. We are committed to creating an inclusive environment that encourages innovation, collaboration, and continuous learning. As a PMO Intern, you will gain meaningful experience, workalongsideexperiencedprofessionals,andcontributetoprojectsthatsupportbusinessgrowthandcustomersuccess.Webelievediverseperspectivesstrengthenourteamsandhelpusdeliverbetteroutcomesforourcustomersandcommunities.

More Info

Job Type:
Employment Type:

About Company

ABOUT US WHY EMERSON Our Commitment to Our People At Emerson, we are motivated by a spirit of collaboration that helps our diverse, multicultural teams across the world drive innovation that makes the world healthier, safer, smarter, and more sustainable. And we want you to join us in our bold aspiration. We have built an engaged community of inquisitive, dedicated people who thrive knowing they are welcomed, trusted, celebrated, and empowered to solve the world's most complex problems - for our customers, our communities, and the planet. You'll contribute to this vital work while further developing your skills through our award-winning employee development programs. We are a proud corporate citizen in every city where we operate and are committed to our people, our communities, and the world at large. We take this responsibility seriously and strive to make a positive impact through every endeavor. At Emerson, you'll see firsthand that our people are at the center of everything we do. So, let's go. Let's think differently. Learn, collaborate, and grow. Seek opportunity. Push boundaries. Be empowered to make things better. Speed up to break through. Let's go, together. Accessibility Assistance or Accommodation If you have a disability and are having difficulty accessing or using this website to apply for a position, please contact: idisability.administrator@emerson.com . ABOUT EMERSON Emerson is a global leader in automation technology and software. Through our deep domain expertise and legacy of flawless execution, Emerson helps customers in critical industries like life sciences, energy, power and renewables, chemical and advanced factory automation operate more sustainably while improving productivity, energy security and reliability. With global operations and a comprehensive portfolio of software and technology, we are helping companies implement digital transformation to measurably improve their operations, conserve valuable resources and enhance their safety. We offer equitable opportunities, celebrate diversity, and embrace challenges with confidence that, together, we can make an impact across a broad spectrum of countries and industries. Whether you're an established professional looking for a career change, an undergraduate student exploring possibilities, or a recent graduate with an advanced degree, you'll find your chance to make a difference with Emerson. Join our team - let's go! No calls or agencies please.

Job ID: 152996315

Similar Jobs

Pune, India

Skills:

Ms OfficeactuatorsFluid MechanicsMaterial ScienceMetallurgyNon-destructive testingDestructive testingIsolation valve productsInstrument components

Pune, India

Skills:

actuatorsFluid MechanicsIsolation valvesMaterial ScienceInstrumentation componentsMetallurgy

Beware of Scammers

We don’t charge money for job offers